AMBP

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001497

 

Antibody CAB069436

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 AbFrontier
 

Product name

HPA001497 LF-MA0226 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Serum 

Released in version

2 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Native protein 

Length (aa)

129  

Antigen sequence

VLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMAC
ETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFD
AVKGKCVLFPYGGCQGNGNKFYSEKECRE
 
 

Matching transcripts

AMBP-001 - ENSP00000265132 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human vulva/anal skin shows distinct positivity in plasma.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules along with distinctly stained extracellular material/ Plasma.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:150 1:1200 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not at all consistent with RNAseq data Consistent with RNAseq data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400613)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

39.0 39.0, 26.5, 21.4 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
AMBP-001