ABCA2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA042886

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA042886 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

108 

Antigen sequence

PTISVKEAFYTAAPLTSAGILPVMQSLCPDGQRDEFGFLQYANSTVTQLL
ERLDRVVEEGNLFDPARPSLGSELEALRQHLEALSAGPGTSGSHLDRSTV
SSFSLDSV
 

Matching transcripts

ABCA2-013 - ENSP00000420527 [100%]
ABCA2-016 - ENSP00000418662 [100%]
ABCA2-202 - ENSP00000360666 [100%]
ABCA2-201 - ENSP00000265662 [99%]
ABCA2-002 - ENSP00000344155 [98%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:700 

Literature conformity

Partly consistent with gene/protein characterization data 

RNA consistency

Not done 

         Western Blot

Image

 

Description

 

Target mass (kDa)

270.0, 269.9, 223.1, 108.4 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ABCA2-002
 
ABCA2-013
 
ABCA2-016
 
ABCA2-201
 
ABCA2-202