MTPAP

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA038620

 

Antibody HPA058232

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA038620 HPA058232 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

100 97 

Antigen sequence

ETLELLLKEFFEYFGNFAFDKNSINIRQGREQNKPDSSPLYIQNPFETSL
NISKNVSQSQLQKFVDLARESAWILQQEDTDRPSISSNRPWGLVSLLLPS
 
MQNERREQAQRTVLIHCPEKISENKFLKYLSQFGPINNHFFYESFGLYAV
VEFCQKESIGSLQNGTHTPSTAMETAIPFRSRFFNLKLKNQTSERSR
 

Matching transcripts

MTPAP-001 - ENSP00000263063 [100%]
MTPAP-201 - ENSP00000350820 [100%]
 MTPAP-001 - ENSP00000263063 [100%]
MTPAP-003 - ENSP00000404392 [100%]
MTPAP-004 - ENSP00000394118 [100%]
MTPAP-201 - ENSP00000350820 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts and Leydig cells).
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:125  

Literature conformity

Consistent with gene/protein characterization data  

RNA consistency

Mainly consistent with RNAseq data  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

78.8, 66.2 78.8, 66.2, 25.3, 17.5 

Antibody dilution

1:250 1:140 

Validation WB

Uncertain: No bands detected Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:1650 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria.
More information
 

Antibody dilution

 1:41 

Validation IF

 Supportive: The subcellular location is supported by literature. 
 

ANTIGEN VIEW

? »
 
 
 
MTPAP-001
 
MTPAP-003
 
MTPAP-004
 
MTPAP-201