XPNPEP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA030419

 

Antibody HPA030420

 

Antibody HPA030422

 

Antibody CAB025196

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 R&D systems
 

Product name

HPA030419 HPA030420 HPA030422 MAB2970 

Host species

Rabbit Rabbit Rabbit Mouse 

Clonality

pAb pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

6 6 6 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

84 95 90  

Antigen sequence

AIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSEL
KALCADLSPREKVWVSDKASYAVSETIPKDHRCC
 
DGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLT
DKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPISKQH
 
PICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAA
DKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETN
 
 

Matching transcripts

XPNPEP1-015 - ENSP00000421566 [100%]
XPNPEP1-016 - ENSP00000358697 [100%]
XPNPEP1-201 - ENSP00000324011 [100%]
XPNPEP1-202 - ENSP00000358694 [100%]
XPNPEP1-002 - ENSP00000385388 [93%]
 XPNPEP1-015 - ENSP00000421566 [100%]
XPNPEP1-016 - ENSP00000358697 [100%]
XPNPEP1-201 - ENSP00000324011 [100%]
XPNPEP1-202 - ENSP00000358694 [100%]
 XPNPEP1-015 - ENSP00000421566 [100%]
XPNPEP1-016 - ENSP00000358697 [100%]
XPNPEP1-202 - ENSP00000358694 [100%]
XPNPEP1-201 - ENSP00000324011 [93%]
  

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:500 1:800 1:10 1:3500 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402779)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

74.8, 72.1, 69.9, 62.1, 34.4 74.8, 72.1, 69.9, 62.1 74.8, 72.1, 69.9, 62.1 74.8, 72.1, 69.9, 62.1, 34.4, 26.3 

Antibody dilution

1:250 1:250 1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

    

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
   

Antibody dilution

1:50 1:100   

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.   

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:3000 1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
XPNPEP1-002
 
XPNPEP1-015
 
XPNPEP1-016
 
XPNPEP1-201
 
XPNPEP1-202