RPS6KB1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA039442

 

Antibody CAB003838

 

Antibody CAB018346

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Epitomics
 Santa Cruz Biotechnology
 

Product name

HPA039442 1494-1 sc-230 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb mAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Supernatant Affinity 

Released in version

13 2 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide Synthetic peptide 

Length (aa)

71   

Antigen sequence

VSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAP
LPIRQPNSGPYKKQAFPMISK
 
 
 

Matching transcripts

RPS6KB1-001 - ENSP00000225577 [100%]
RPS6KB1-008 - ENSP00000441993 [100%]
RPS6KB1-201 - ENSP00000376744 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human bone marrow shows distinct nuclear positivity in hematopoietic cells.
More information
 Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
More information
 Immunohistochemical staining of human stomach shows cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:100 1:150 1:65 

Literature conformity

Consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Mainly consistent with RNA expression data Mainly consistent with RNA expression data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:29   

Validation IF

Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody.   

         Western blot - siRNA

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: siRNA 1
Lane 3: siRNA 2
Lane 4: Scrambled
More information
 Application not done for this antibody. Application not done for this antibody. 

Target mass (kDa)

59.1, 56.6, 53.0   

Loading control

Total protein image   

Antibody dilution

1:64   

Validation WB-siRNA

Supportive: Downregulation visible in one of two siRNA lanes   

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

59.1, 56.6, 53.0 59.1, 56.6, 53.0, 51.0, 6.9 59.1, 56.6, 53.0, 51.0, 6.9 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3000   

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).   
 

ANTIGEN VIEW

? »
 
 
 
RPS6KB1-001
 
RPS6KB1-008
 
RPS6KB1-201