CAMTA2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA051147

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA051147 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

59 

Antigen sequence

EKRMAEIAAAGQVPCQGPDAPPVQDEGQGPGFEARVVVLVESMIPRSTWK
GPERLAHGS
 

Matching transcripts

CAMTA2-001 - ENSP00000321813 [100%]
CAMTA2-002 - ENSP00000354828 [100%]
CAMTA2-003 - ENSP00000412886 [100%]
CAMTA2-004 - ENSP00000370712 [100%]
CAMTA2-007 - ENSP00000460779 [100%]
CAMTA2-201 - ENSP00000350910 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:32 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

134.8, 132.1, 131.5, 130.9, 130.7 

Antibody dilution

1:160 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:1250 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
CAMTA2-001
 
CAMTA2-002
 
CAMTA2-003
 
CAMTA2-004
 
CAMTA2-007
 
CAMTA2-201