ALDH3A1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA051150

 

Antibody CAB045957

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Origene
 

Product name

HPA051150 TA501139 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

11 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

47  

Antigen sequence

NSGMGSYHGKKSFETFSHRRSCLVRPLMNDEGLKVRYPPSPAKMTQH
 
 

Matching transcripts

ALDH3A1-001 - ENSP00000225740 [100%]
ALDH3A1-005 - ENSP00000460482 [100%]
ALDH3A1-007 - ENSP00000378923 [100%]
ALDH3A1-010 - ENSP00000411821 [100%]
ALDH3A1-201 - ENSP00000388469 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human stomach, lower shows strong cytoplasmic and nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human esophagus shows strong cytoplasmic and nuclear staining in squamous epithelial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:600 1:30000 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

50.4, 43.3, 41.9 50.4, 44.2, 43.3, 41.9, 41.6, 29.1, 15.0, 14.0, 8.7 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-549 shows positivity in plasma membrane & cytoplasm.
More information
  

Antibody dilution

1:50  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:2000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ALDH3A1-001
 
ALDH3A1-005
 
ALDH3A1-007
 
ALDH3A1-010
 
ALDH3A1-201