CLNK

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035671

 

Antibody HPA035672

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA035671 HPA035672 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

87 72 

Antigen sequence

PIKESEYADTHYFKVAMDTPLPLDTRTSISIGQPTWNTQTRLERVDKPIS
KDVRSQNIKGDASVRKNKIPLPPPRPLITLPKKYQPL
 
QGNRKTTKEGSNDLKFQNFSLPKNRSWPRINSATGQYQRMNKPLLDWERN
FAAVLDGAKGHSDDDYDDPELR
 

Matching transcripts

CLNK-001 - ENSP00000226951 [100%]
CLNK-002 - ENSP00000427208 [100%]
CLNK-201 - ENSP00000390744 [100%]
 CLNK-001 - ENSP00000226951 [100%]
CLNK-201 - ENSP00000390744 [99%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in a subset of leukocytes in non-germinal centre cells.
More information
 Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in a subset of leukocytes in non-germinal centre cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:200 1:25 

Literature conformity

Partly consistent with gene/protein characterization data Partly consistent with gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in vesicles.
More information
 Immunofluorescent staining of human cell line U-2 OS shows no positivity.
More information
 

Antibody dilution

1:172 1:47 

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

  

Description

  

Target mass (kDa)

49.6, 49.5, 19.4 49.6, 49.5 

Antibody dilution

1:250 1:250 

Validation WB

Current setup is not applicable due to low RNA count Current setup is not applicable due to low RNA count 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CLNK-001
 
CLNK-002
 
CLNK-201