CRYAB

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA057100

 

Antibody CAB002053

 

Antibody CAB040560

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Novocastra
 NCI-CPTC
 

Product name

HPA057100 NCL-ABCrys-512 CPTC-CRYAB-1 

Host species

Rabbit Mouse Mouse 

Clonality

pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known Protein A/G 

Released in version

14 1 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known Recombinant protein 

Length (aa)

52   

Antigen sequence

KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVT
AA
 
 
 

Matching transcripts

CRYAB-001 - ENSP00000436051 [100%]
CRYAB-002 - ENSP00000433560 [100%]
CRYAB-003 - ENSP00000227251 [100%]
CRYAB-005 - ENSP00000436089 [100%]
CRYAB-008 - ENSP00000435411 [100%]
CRYAB-009 - ENSP00000435960 [100%]
CRYAB-010 - ENSP00000434793 [100%]
CRYAB-011 - ENSP00000435046 [100%]
CRYAB-012 - ENSP00000432454 [100%]
CRYAB-013 - ENSP00000437149 [100%]
CRYAB-015 - ENSP00000434247 [100%]
CRYAB-201 - ENSP00000483554 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
More information
 Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
More information
 Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:150 1:160 1:4000 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Consistent with RNA expression data Mainly consistent with RNA expression data Mainly consistent with RNA expression data 

         Immunofluorescence

Image

   

Description

Application not done for this antibody. Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane & cytoplasm.
More information
 

Antibody dilution

 1:40 1:50 

Validation IF

 Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

20.2, 20.0, 12.3, 12.0, 11.7 20.2, 20.0, 17.9, 15.4, 12.3, 12.0, 11.7, 9.2, 8.2 20.2, 20.0, 17.9, 15.4, 12.3, 12.0, 11.7, 9.2, 8.2 

Antibody dilution

1:80 1:500 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:500   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 « 
 
CRYAB-001
 
CRYAB-002
 
CRYAB-003
 
CRYAB-005
 
CRYAB-008
 
CRYAB-009
 
CRYAB-010
 
CRYAB-011
 
CRYAB-012
 
CRYAB-013
 
CRYAB-015
 
CRYAB-201
 
 »