PPFIBP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001924

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA001924 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

124 

Antigen sequence

DAQGFSDLEKSPSPTPVMGSPSCDPFNTSVPEEFHTTILQVSIPSLLPAT
VSMETSEKSKLTPKPETSFEENDGNIILGATVDTQLCDKLLTSSLQKSSS
LGNLKKETSDGEKETIQKTSEDRA
 

Matching transcripts

PPFIBP1-001 - ENSP00000228425 [100%]
PPFIBP1-002 - ENSP00000444304 [100%]
PPFIBP1-003 - ENSP00000445425 [100%]
PPFIBP1-007 - ENSP00000314724 [100%]
PPFIBP1-008 - ENSP00000443442 [100%]
PPFIBP1-016 - ENSP00000443324 [90%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in epidermal cells and adnexal cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:500 

Literature conformity

Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane & cytoplasm.
More information
 

Antibody dilution

1:182 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

114.0, 113.2, 110.3, 97.0, 84.1, 22.4 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
PPFIBP1-001
 
PPFIBP1-002
 
PPFIBP1-003
 
PPFIBP1-007
 
PPFIBP1-008
 
PPFIBP1-016