LTA4H

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA008399

 

Antibody HPA017017

 

Antibody CAB015221

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA008399 HPA017017 2234 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

5 5 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Genetic immunization 

Length (aa)

140 142  

Antigen sequence

ALTVQSQEDNLRSLVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEI
SLPIALSKNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAI
HCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGET
 
YLERHICGRLFGEKFRHFNALGGWGELQNSVKTFGETHPFTKLVVDLTDI
DPDVAYSSVPYEKGFALLFYLEQLLGGPEIFLGFLKAYVEKFSYKSITTD
DWKDFLYSYFKDKVDVLNQVDWNAWLYSPGLPPIKPNYDMTL
 
 

Matching transcripts

LTA4H-001 - ENSP00000228740 [100%]
LTA4H-002 - ENSP00000395051 [90%]
LTA4H-003 - ENSP00000449958 [90%]
 LTA4H-001 - ENSP00000228740 [100%]
LTA4H-002 - ENSP00000395051 [100%]
LTA4H-003 - ENSP00000449958 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human adrenal gland shows strong nuclear and cytoplasmic positivity in cortical cells.
More information
 Immunohistochemical staining of human fallopian tube shows strong nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human colon shows nuclear and cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:100 1:150 1:250 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
More information
 

Antibody dilution

1:62 1:20 1:62 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Supportive: The subcellular location is supported by literature. Non-supportive: The subcellular location is not consistent with literature. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

69.3, 66.9, 57.3 69.3, 66.9, 57.3 69.3, 66.9, 57.3, 14.5 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
LTA4H-001
 
LTA4H-002
 
LTA4H-003