TRPV4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007150

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA007150 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

98 

Antigen sequence

EDGSLSPSPADASRPAGPGDGRPNLRMKFQGAFRKGVPNPIDLLESTLYE
SSVVPGPKKAPMDSLFDYGTYRHHSSDNKRWRKKIIEKQPQSPKAPAP
 

Matching transcripts

TRPV4-001 - ENSP00000261740 [100%]
TRPV4-002 - ENSP00000443611 [100%]
TRPV4-003 - ENSP00000442738 [100%]
TRPV4-004 - ENSP00000442167 [100%]
TRPV4-006 - ENSP00000406191 [100%]
TRPV4-007 - ENSP00000437449 [100%]
TRPV4-201 - ENSP00000319003 [100%]
TRPV4-202 - ENSP00000376480 [100%]
TRPV4-005 - ENSP00000444336 [87%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islet cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:15 

Literature conformity

Consistent with extensive gene/protein characterization data 

RNA consistency

Not at all consistent with RNAseq data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407795)
More information
 

Target mass (kDa)

98.3, 95.0, 92.9, 91.3, 85.9, 61.8 

Antibody dilution

1:125 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
TRPV4-001
 
TRPV4-002
 
TRPV4-003
 
TRPV4-004
 
TRPV4-005
 
TRPV4-006
 
TRPV4-007
 
TRPV4-201
 
TRPV4-202