FOXM1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA029974

 

Antibody HPA029975

 

Antibody HPA029976

 

Antibody CAB017832

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA029974 HPA029975 HPA029976 2630.00.02 

Host species

Rabbit Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

7 7 7 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Genetic immunization 

Length (aa)

92 80 98  

Antigen sequence

GIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIK
VESPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGL
 
PLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIIN
HPTMPNTQVVAIPNNANIHSIITALTAKGK
 
RRKQHLLPPCVDEPELLFSEGPSTSRWAAELPFPADSSDPASQLSYSQEV
GGPFKTPIKETLPISSTPSKSVLPRTPESWRLTPPAKVGGLDFSPVQT
 
 

Matching transcripts

FOXM1-001 - ENSP00000354492 [100%]
FOXM1-002 - ENSP00000352901 [100%]
FOXM1-003 - ENSP00000342307 [100%]
 FOXM1-001 - ENSP00000354492 [100%]
FOXM1-002 - ENSP00000352901 [100%]
FOXM1-003 - ENSP00000342307 [100%]
 FOXM1-001 - ENSP00000354492 [100%]
FOXM1-002 - ENSP00000352901 [100%]
FOXM1-003 - ENSP00000342307 [100%]
  

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human breast shows strong nuclear and extracellular positivity in glandular cells.
More information
 Immunohistochemical staining of human testis shows distinct cytoplasmic positivity in cells in seminiferus ducts.
More information
 Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
More information
 Immunohistochemical staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:225 1:25 1:80 1:45 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Immunofluorescence

Image

    

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows no positivity.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli & vesicles.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus, nucleoli & cytoplasm.
More information
 

Antibody dilution

1:200 1:50 1:100 1:11 

Validation IF

Supportive: The subcellular location is supported by literature. Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

88.6, 84.3, 82.7 88.6, 84.3, 82.7 88.6, 84.3, 82.7 88.6, 84.3, 82.7, 22.9, 8.3 

Antibody dilution

1:250 1:250 1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
FOXM1-001
 
FOXM1-002
 
FOXM1-003