BRD8

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001841

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA001841 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

147 

Antigen sequence

EASPESMLSPSHGSNPIEDPLEAETQHKFEMSDSLKEESGTIFGSQIKDA
PGEDEEEDGVSEAASLEEPKEEDQGEGYLSEMDNEPPVSESDDGFSIHNA
TLQSHTLADSIPSSPASSQFSVCSEDQEAIQAQKIWKKAIMLVWRAA
 

Matching transcripts

BRD8-001 - ENSP00000254900 [100%]
BRD8-002 - ENSP00000230901 [100%]
BRD8-003 - ENSP00000398067 [100%]
BRD8-004 - ENSP00000398873 [100%]
BRD8-005 - ENSP00000398084 [100%]
BRD8-006 - ENSP00000384845 [100%]
BRD8-201 - ENSP00000394330 [100%]
BRD8-202 - ENSP00000408396 [100%]
BRD8-026 - ENSP00000426385 [99%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:150 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in nucleus but not nucleoli & mitochondria.
More information
 

Antibody dilution

1:25 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

135.3, 102.8, 96.8, 95.4, 94.3, 93.8, 93.3, 91.1, 21.1 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
BRD8-001
 
BRD8-002
 
BRD8-003
 
BRD8-004
 
BRD8-005
 
BRD8-006
 
BRD8-026
 
BRD8-201
 
BRD8-202