SKP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA053745

 

Antibody HPA058134

 

Antibody CAB012982

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Zymed
 

Product name

HPA053745 HPA058134 32-3800 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

13 13 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

84 79  

Antigen sequence

KRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKG
KTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
 
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNV
NAAILKKVIQWCTHHKDDPPPPEDDENKE
 
 

Matching transcripts

SKP1-001 - ENSP00000231487 [100%]
SKP1-004 - ENSP00000429961 [100%]
SKP1-005 - ENSP00000429686 [100%]
SKP1-002 - ENSP00000429472 [90%]
SKP1-008 - ENSP00000331708 [87%]
SKP1-009 - ENSP00000431067 [87%]
 SKP1-001 - ENSP00000231487 [100%]
SKP1-002 - ENSP00000429472 [100%]
SKP1-003 - ENSP00000429415 [100%]
SKP1-004 - ENSP00000429961 [100%]
SKP1-005 - ENSP00000429686 [100%]
SKP1-006 - ENSP00000429996 [100%]
SKP1-008 - ENSP00000331708 [100%]
SKP1-009 - ENSP00000431067 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Application not done for this antibody. Application not done for this antibody. Immunohistochemical staining of human cerebellum shows strong nuclear and cytoplasmic positivity in cerebellar tissue.
More information
 

Retrieval method

  HIER pH6 

Antibody dilution

  1:75 

Literature conformity

  No avaliable characterization data 

RNA consistency

  Not done 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 213, 118, 83, 50, 33, 26, 18
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

18.7, 18.1, 17.9 18.7, 18.1, 17.9, 16.0, 11.6 18.7, 18.1, 17.9, 16.0, 11.6, 4.6, 4.3, 2.0 

Antibody dilution

1:110 1:130 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line MCF7 shows positivity in nucleus & cytoplasm.
More information
 Immunofluorescent staining of human cell line MCF7 shows positivity in nucleus.
More information
 Application not done for this antibody. 

Antibody dilution

1:23 1:39  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:900 1:1550  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
SKP1-001
 
SKP1-002
 
SKP1-003
 
SKP1-004
 
SKP1-005
 
SKP1-006
 
SKP1-008
 
SKP1-009