ATP6V1A

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035083

 

Antibody HPA035084

 

Antibody CAB006910

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Upstate
 

Product name

HPA035083 HPA035084 05-382 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 12 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Native protein 

Length (aa)

87 94  

Antigen sequence

AIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTM
EVDGKVESIMKRTALVANTSNMPVAAREASIYTGITL
 
YVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEE
TSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQT
 
 

Matching transcripts

ATP6V1A-001 - ENSP00000273398 [100%]
ATP6V1A-201 - ENSP00000439874 [100%]
 ATP6V1A-001 - ENSP00000273398 [100%]
ATP6V1A-005 - ENSP00000419294 [100%]
ATP6V1A-006 - ENSP00000417545 [85%]
ATP6V1A-201 - ENSP00000439874 [85%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

  Immunohistochemical staining of human placenta shows strong cytoplasmic and nuclear positivity in trophoblastic cells.
More information
 

Retrieval method

  HIER pH6 

Antibody dilution

  1:200 

Validation IH

  Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

68.3, 64.7 68.3, 64.7, 24.2, 20.2 68.3, 64.7, 24.2, 20.2, 5.4 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus, cytoplasm & vesicles.
More information
  

Antibody dilution

1:200 1:123  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ATP6V1A-001
 
ATP6V1A-005
 
ATP6V1A-006
 
ATP6V1A-201