NEK11

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA016908

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA016908 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

122 

Antigen sequence

DFGVSRLLMGSCDLATTLTGTPHYMSPEALKHQGYDTKSDIWSLACILYE
MCCMNHAFAGSNFLSIVLKIVEGDTPSLPERYPKELNAIMESMLNKNPSL
RPSAIEILKIPYLDEQLQNLMC
 

Matching transcripts

NEK11-001 - ENSP00000426662 [100%]
NEK11-003 - ENSP00000372857 [100%]
NEK11-004 - ENSP00000425114 [100%]
NEK11-006 - ENSP00000423458 [100%]
NEK11-010 - ENSP00000421851 [100%]
NEK11-201 - ENSP00000349389 [100%]
NEK11-202 - ENSP00000411888 [100%]
NEK11-203 - ENSP00000397180 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human testis shows strong nuclear positivity in subsets of cells in ductus seminiferus.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:1000 

Literature conformity

Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly not consistent with RNAseq data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:83 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

74.2, 68.9, 55.5, 54.0, 53.2 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
NEK11-001
 
NEK11-003
 
NEK11-004
 
NEK11-006
 
NEK11-010
 
NEK11-201
 
NEK11-202
 
NEK11-203