PLSCR4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002276

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA002276 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

143 

Antigen sequence

PQQPSTFPLYQPVGGIHPVRYQPGKYPMPNQSVPITWMPGPTPMANCPPG
LEYLVQLDNIHVLQHFEPLEMMTCFETNNRYDIKNNSDQMVYIVTEDTDD
FTRNAYRTLRPFVLRVTDCMGREIMTMQRPFRCTCCCFCCPSA
 

Matching transcripts

PLSCR4-001 - ENSP00000347038 [100%]
PLSCR4-003 - ENSP00000419040 [100%]
PLSCR4-004 - ENSP00000399315 [100%]
PLSCR4-005 - ENSP00000417896 [100%]
PLSCR4-007 - ENSP00000418173 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human adrenal gland shows strong cytoplasmic and membranous positivity in cortical cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:25 

Literature conformity

Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line SiHa shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:35 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

37.0, 29.4, 23.4 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
PLSCR4-001
 
PLSCR4-003
 
PLSCR4-004
 
PLSCR4-005
 
PLSCR4-007