GRB14

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035052

 

Antibody HPA035053

 

Antibody CAB022294

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Chemicon
 

Product name

HPA035052 HPA035053 MAB1167 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

13 13 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

70 90  

Antigen sequence

KEPRHLQFFSEFGNSDIYVSLAGKKKHGAPTNYGFCFKPNKAGGPRDLKM
LCAEEEQSRTCWVTAIRLLK
 
PELCCSPFTSVLSADLFPKANSRKKQVIKVYSEDETSRALDVPSDITARD
VCQLLILKNHYIDDHSWTLFEHLPHIGVERTIEDHELVIE
 
 

Matching transcripts

GRB14-001 - ENSP00000263915 [100%]
GRB14-002 - ENSP00000416786 [100%]
GRB14-201 - ENSP00000443699 [100%]
 GRB14-001 - ENSP00000263915 [100%]
GRB14-002 - ENSP00000416786 [100%]
GRB14-005 - ENSP00000401702 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Application not done for this antibody. Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts, Leydig cells were strongly stained.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.
More information
 

Retrieval method

 HIER pH6 HIER pH6 

Antibody dilution

 1:55 1:15 

Literature conformity

 Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

 Mainly not consistent with RNAseq data Mainly not consistent with RNAseq data 

         Western Blot

Image

   

Description

 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

61.0, 51.9, 47.6 61.0, 47.6, 18.3 61.0, 51.9, 47.6, 18.3 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line A549 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:5   

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.   

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:500 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
GRB14-001
 
GRB14-002
 
GRB14-005
 
GRB14-201