GRB14

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035052

 

Antibody HPA035053

 

Antibody CAB022294

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Chemicon
 

Product name

HPA035052 HPA035053 MAB1167 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

14 13 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

70 90  

Antigen sequence

KEPRHLQFFSEFGNSDIYVSLAGKKKHGAPTNYGFCFKPNKAGGPRDLKM
LCAEEEQSRTCWVTAIRLLK
 
PELCCSPFTSVLSADLFPKANSRKKQVIKVYSEDETSRALDVPSDITARD
VCQLLILKNHYIDDHSWTLFEHLPHIGVERTIEDHELVIE
 
 

Matching transcripts

GRB14-001 - ENSP00000263915 [100%]
GRB14-002 - ENSP00000416786 [100%]
 GRB14-001 - ENSP00000263915 [100%]
GRB14-002 - ENSP00000416786 [100%]
GRB14-005 - ENSP00000401702 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Application not done for this antibody. Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts, Leydig cells were strongly stained.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.
More information
 

Retrieval method

 HIER pH6 HIER pH6 

Antibody dilution

 1:55 1:15 

Literature conformity

 Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

 Mainly not consistent with RNA expression data Mainly not consistent with RNA expression data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line A549 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:5   

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available.   

         Western Blot

Image

   

Description

   

Target mass (kDa)

61.0, 47.6 61.0, 47.6, 18.3 61.0, 47.6, 18.3 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Current setup is not applicable due to low RNA count Current setup is not applicable due to low RNA count Current setup is not applicable due to low RNA count 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:500 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
GRB14-001
 
GRB14-002
 
GRB14-005