LPHN2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA013573

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA013573 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

122 

Antigen sequence

NQLYVWNNNFILRYSLEFGPPDPAQVPTTAVTITSSAELFKTIISTTSTT
SQKGPMSTTVAGSQEGSKGTKPPPAVSTTKIPPITNIFPLPERFCEALDS
KGIKWPQTQRGMMVERPCPKGT
 

Matching transcripts

LPHN2-001 - ENSP00000353006 [100%]
LPHN2-002 - ENSP00000359750 [100%]
LPHN2-003 - ENSP00000359748 [100%]
LPHN2-004 - ENSP00000322270 [100%]
LPHN2-007 - ENSP00000359763 [100%]
LPHN2-008 - ENSP00000359765 [100%]
LPHN2-009 - ENSP00000359762 [100%]
LPHN2-010 - ENSP00000359760 [100%]
LPHN2-011 - ENSP00000359758 [100%]
LPHN2-012 - ENSP00000397740 [100%]
LPHN2-201 - ENSP00000271029 [100%]
LPHN2-202 - ENSP00000337306 [100%]
LPHN2-203 - ENSP00000359752 [100%]
LPHN2-204 - ENSP00000378344 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:40 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

165.1, 163.4, 163.3, 160.5, 158.8, 157.2, 151.1, 132.2, 126.2 

Antibody dilution

1:250 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 « 
 
LPHN2-001
 
LPHN2-002
 
LPHN2-003
 
LPHN2-004
 
LPHN2-007
 
LPHN2-008
 
LPHN2-009
 
LPHN2-010
 
LPHN2-011
 
LPHN2-012
 
LPHN2-201
 
LPHN2-202
 
LPHN2-203
 
LPHN2-204
 
 »