RPS6KA1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007981

 

Antibody CAB003852

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Epitomics
 

Product name

HPA007981 2004-1 

Host species

Rabbit Rabbit 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Supernatant 

Released in version

3 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

82  

Antigen sequence

KMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYS
ALNSSKPTPQLKPIESSILAQRRVRKLPSTTL
 
 

Matching transcripts

RPS6KA1-001 - ENSP00000363283 [100%]
RPS6KA1-003 - ENSP00000432281 [100%]
RPS6KA1-006 - ENSP00000403548 [100%]
RPS6KA1-008 - ENSP00000435412 [100%]
RPS6KA1-009 - ENSP00000431651 [100%]
RPS6KA1-010 - ENSP00000363281 [100%]
RPS6KA1-201 - ENSP00000363277 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:10 1:300 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows no positivity.
More information
 

Antibody dilution

1:20 1:75 

Validation IF

Supportive: The subcellular location is supported by literature. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

83.9, 82.7, 81.5, 81.1, 72.7, 13.1 83.9, 82.7, 81.5, 81.1, 72.7, 23.0, 18.7, 13.1, 12.3, 6.1, 5.9 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
RPS6KA1-001
 
RPS6KA1-003
 
RPS6KA1-006
 
RPS6KA1-008
 
RPS6KA1-009
 
RPS6KA1-010
 
RPS6KA1-201