APOA1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA046715

 

Antibody CAB016778

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 BioPorto Diagnostics A/S
 

Product name

HPA046715 HYB 069-01 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Native protein 

Length (aa)

84  

Antigen sequence

SKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKK
WQEEMELYRQKVEPLRAELQEGARQKLHELQEKL
 
 

Matching transcripts

APOA1-001 - ENSP00000236850 [100%]
APOA1-002 - ENSP00000364469 [100%]
APOA1-003 - ENSP00000364472 [100%]
APOA1-004 - ENSP00000352471 [100%]
APOA1-005 - ENSP00000364478 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
More information
 Immunohistochemical staining of human kidney shows weak cytoplasmic positivity in renal tubules and extracellular material .
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:10000 1:14000 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

30.8, 27.9 30.8, 27.9 

Antibody dilution

1:740 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line Hep-G2 shows positivity in vesicles.
More information
  

Antibody dilution

1:147  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:5900  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
APOA1-001
 
APOA1-002
 
APOA1-003
 
APOA1-004
 
APOA1-005