ATF6

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA005935

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA005935 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

125 

Antigen sequence

EAQDTSDGIIQKNSYRYDHSVSNDKALMVLTEEPLLYIPPPPCQPLINTT
ESLRLNHELRGWVHRHEVERTKSRRMTNNQQKTRILQGALEQGSNSQLMA
VQYTETTSSISRNSGSELQVYYASP
 

Matching transcripts

ATF6-001 - ENSP00000356919 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:150 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

74.6 

Antibody dilution

1:250 

Validation WB

Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ATF6-001