ALDH6A1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA029072

 

Antibody HPA029073

 

Antibody HPA029074

 

Antibody HPA029075

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA029072 HPA029073 HPA029074 HPA029075 

Host species

Rabbit Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 6 6 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

80 96 79 93 

Antigen sequence

SCKRAFPAWADTSVLSRQQVLLRYQQLIKENLKEIAKLITLEQGKTLADA
EGDVFRGLQVVEHACSVTSLMMGETMPSIT
 
RCMALSTAVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKE
RVCNLIDSGTKEGASILLDGRKIKVKGYENGNFVGPTIISNVKPNM
 
GNTFLMKPSERVPGATMLLAKLLQDSGAPDGTLNIIHGQHEAVNFICDHP
DIKAISFVGSNKAGEYIFERGSRHGKRVQ
 
NNNPYGNGTAIFTTNGATARKYAHLVDVGQVGVNVPIPVPLPMFSFTGSR
SSFRGDTNFYGKQGIQFYTQLKTITSQWKEEDATLSSPAVVMP
 

Matching transcripts

ALDH6A1-001 - ENSP00000450436 [100%]
ALDH6A1-002 - ENSP00000342564 [84%]
 ALDH6A1-001 - ENSP00000450436 [100%]
ALDH6A1-002 - ENSP00000342564 [100%]
ALDH6A1-007 - ENSP00000452081 [100%]
 ALDH6A1-001 - ENSP00000450436 [100%]
ALDH6A1-002 - ENSP00000342564 [100%]
 ALDH6A1-001 - ENSP00000450436 [100%]
ALDH6A1-002 - ENSP00000342564 [100%]
ALDH6A1-007 - ENSP00000452081 [100%]
 

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human liver shows strong cytoplasmic positivity with a granular pattern in hepatocytes.
More information
 Immunohistochemical staining of human liver shows strong cytoplasmic positivity(granular pattern) in hepatocytes.
More information
 Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
More information
 Immunohistochemical staining of human liver shows strong cytoplasmic positivity with a granular pattern in hepatocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:400 1:600 1:800 1:550 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

57.8, 56.2 57.8, 56.2, 27.0 57.8, 56.2 57.8, 56.2, 27.0 

Antibody dilution

1:250 1:250 1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

    

Description

 Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria & nucleus but excluded from the nucleoli.
More information
   

Antibody dilution

 1:100   

Validation IF

 Supportive: The subcellular location is supported by literature.   
 

ANTIGEN VIEW

? »
 
 
 
ALDH6A1-001
 
ALDH6A1-002
 
ALDH6A1-007