ATL2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA029108

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA029108 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

58 

Antigen sequence

EFREIGTVIDQIAETLWEQRSPRKVFSKLFEVTRRRMVHRALSSAQRQRL
SSNNNKKK
 

Matching transcripts

ATL2-013 - ENSP00000385446 [100%]
ATL2-201 - ENSP00000333393 [100%]
ATL2-203 - ENSP00000438938 [100%]
ATL2-001 - ENSP00000415336 [91%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human duodenum shows distinct cytoplasmic positivity with a granular pattern in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:10 

Literature conformity

No avaliable characterization data 

RNA consistency

Not done 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

66.1, 65.0, 47.4 

Antibody dilution

1:250 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ATL2-001
 
ATL2-013
 
ATL2-201
 
ATL2-203