ELF1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001755

 

Antibody HPA048866

 

Antibody CAB005172

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA001755 HPA048866 sc-631 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

2 13 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

135 149  

Antigen sequence

PSSSIESSDPSLSSSATSNRNQTSRSRVSSSPGVKGGATTVLKPGNSKAA
KPKDPVEVAQPSEVLRTVQPTQSPYPTQLFRTVHVVQPVQAVPEGEAART
STMQDETLNSSVQSIRTIQAPTQVPVVVSPRNQQL
 
QAIPSSQPMTVLKENVMLQSQKAGSPPSIVLGPAQVQQVLTSNVQTICNG
TVSVASSPSFSATAPVVTFSPRSSQLVAHPPGTVITSVIKTQETKTLTQE
VEKKESEDHLKENTEKTEQQPQPYVMVVSSSNGFTSQVAMKQNELLEPN
 
 

Matching transcripts

ELF1-003 - ENSP00000239882 [100%]
ELF1-201 - ENSP00000405580 [100%]
 ELF1-003 - ENSP00000239882 [100%]
ELF1-201 - ENSP00000405580 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human lymph node shows distinct nuclear positivity in germinal center cells.
More information
 Application not done for this antibody. Immunohistochemical staining of human lymph node shows distinct nuclear positivity in all cells.
More information
 

Retrieval method

HIER pH6  HIER pH6 

Antibody dilution

1:150  1:500 

Literature conformity

Partly consistent with extensive gene/protein characterization data  Consistent with extensive gene/protein characterization data 

RNA consistency

Not done  Not done 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 229, 112, 83.5, 47.9, 32.3, 26.5, 17.2
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

67.5, 64.9 67.5, 64.9 67.5, 64.9, 2.8 

Antibody dilution

1:250 1:420 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:3350  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  

         Immunofluorescence

Image

   

Description

Application not done for this antibody. Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

 1:84 1:125 

Validation IF

 Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 
 

ANTIGEN VIEW

? »
 
 
 
ELF1-003
 
ELF1-201