P4HA1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007599

 

Antibody HPA026593

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA007599 HPA026593 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

146 142 

Antigen sequence

FTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLEQIKKWAEKLDRLTSTAT
KDPEGFVGHPVNAFKLMKRLNTEWSELENLVLKDMSDGFISNLTIQRQYF
PNDEDQVGAAKALLRLQDTYNLDTDTISKGNLPGVKHKSFLTAEDC
 
DYYHTELWMEQALRQLDEGEISTIDKVSVLDYLSYAVYQQGDLDKALLLT
KKLLELDPEHQRANGNLKYFEYIMAKEKDVNKSASDDQSDQKTTPKKKGV
AVDYLPERQKYEMLCRGEGIKMTPRRQKKLFCRYHDGNRNPK
 

Matching transcripts

P4HA1-001 - ENSP00000307318 [100%]
P4HA1-002 - ENSP00000362099 [100%]
P4HA1-201 - ENSP00000263556 [100%]
P4HA1-202 - ENSP00000378353 [100%]
P4HA1-203 - ENSP00000411688 [100%]
P4HA1-204 - ENSP00000414464 [100%]
 P4HA1-001 - ENSP00000307318 [100%]
P4HA1-002 - ENSP00000362099 [100%]
P4HA1-201 - ENSP00000263556 [100%]
P4HA1-202 - ENSP00000378353 [100%]
P4HA1-203 - ENSP00000411688 [100%]
P4HA1-204 - ENSP00000414464 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
More information
 Immunohistochemical staining of human spleen shows strong cytoplasmic and nuclear positivity in cells in red pulp.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:35 1:1800 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in endoplasmic reticulum.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in endoplasmic reticulum & vesicles.
More information
 

Antibody dilution

1:10 1:118 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

61.0, 59.0 61.0, 59.0 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
P4HA1-001
 
P4HA1-002
 
P4HA1-201
 
P4HA1-202
 
P4HA1-203
 
P4HA1-204