ARHGAP9

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA051447

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA051447 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

93 

Antigen sequence

NPGSMEGTQTLKRNNDVLQPQAKGFRSDTGTPEPLDPQGSLSLSQRTSQL
DPPALQAPRPLPQLLDDPHEVEKSGLLNMTKIAQGGRKLRKNW
 

Matching transcripts

ARHGAP9-001 - ENSP00000377380 [100%]
ARHGAP9-002 - ENSP00000377386 [100%]
ARHGAP9-003 - ENSP00000473445 [100%]
ARHGAP9-005 - ENSP00000394307 [100%]
ARHGAP9-006 - ENSP00000397950 [100%]
ARHGAP9-020 - ENSP00000449829 [100%]
ARHGAP9-201 - ENSP00000348782 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human prostate shows strong cytoplasmic and nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:400 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

90.6, 83.3, 81.1, 80.8, 70.9, 61.2, 33.0 

Antibody dilution

1:330 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2650 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ARHGAP9-001
 
ARHGAP9-002
 
ARHGAP9-003
 
ARHGAP9-005
 
ARHGAP9-006
 
ARHGAP9-020
 
ARHGAP9-201