CDK2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA066915

 

Antibody CAB013115

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 BioSource
 

Product name

HPA066915 AHZ0142 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

14 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

39  

Antigen sequence

PSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRIS
 
 

Matching transcripts

CDK2-001 - ENSP00000266970 [100%]
CDK2-002 - ENSP00000243067 [100%]
CDK2-003 - ENSP00000393605 [100%]
CDK2-007 - ENSP00000452514 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human duodenum shows nuclear and cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:50 

Literature conformity

 Partly consistent with extensive gene/protein characterization data 

RNA consistency

 Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line SK-MEL-30 shows positivity in centrosome & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:164  

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available.  

         GFP

Image

  

Description

Immunofluorescent staining of transgenic HeLa cells show antibody staining in cytoplasm & nucleus but excluded from the nucleoli and GFP expression in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:164  

Validation IFGFP

Supportive: Antibody staining overlaps with GFP tagged protein  

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 213, 118, 83, 50, 33, 26, 18
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

39.2, 33.9, 30.0, 27.2 39.2, 33.9, 30.0, 27.2 

Antibody dilution

1:550 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:6550  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CDK2-001
 
CDK2-002
 
CDK2-003
 
CDK2-007