BAZ2B

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA019819

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA019819 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

105 

Antigen sequence

NAGANGCTLSYQNSGKHSLGSVQSTATQSNVEKADSNNLFNTGSSGPGKF
YSPLPNDQLLKTLTEKNRQWFSLLPRTPCDDTSLTHADMSTASLVTPQSQ
PPSKS
 

Matching transcripts

BAZ2B-001 - ENSP00000376534 [100%]
BAZ2B-002 - ENSP00000376533 [100%]
BAZ2B-201 - ENSP00000339670 [100%]
BAZ2B-202 - ENSP00000348087 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in renal tubules.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:75 

Literature conformity

Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done 

         Western Blot

Image

 

Description

 

Target mass (kDa)

240.5, 236.6, 236.4, 230.2 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
BAZ2B-001
 
BAZ2B-002
 
BAZ2B-201
 
BAZ2B-202