ST3GAL3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA051102

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA051102 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

71 

Antigen sequence

KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKY
ANFSEGACKPGYASALMTAIF
 

Matching transcripts

ST3GAL3-001 - ENSP00000355341 [100%]
ST3GAL3-003 - ENSP00000361444 [100%]
ST3GAL3-009 - ENSP00000361440 [100%]
ST3GAL3-012 - ENSP00000361437 [100%]
ST3GAL3-016 - ENSP00000437206 [100%]
ST3GAL3-018 - ENSP00000431700 [100%]
ST3GAL3-027 - ENSP00000432965 [100%]
ST3GAL3-028 - ENSP00000432071 [100%]
ST3GAL3-030 - ENSP00000435621 [100%]
ST3GAL3-032 - ENSP00000434686 [100%]
ST3GAL3-202 - ENSP00000333494 [100%]
ST3GAL3-205 - ENSP00000330463 [100%]
ST3GAL3-208 - ENSP00000361452 [100%]
ST3GAL3-006 - ENSP00000317192 [81%]
ST3GAL3-007 - ENSP00000355201 [81%]
ST3GAL3-209 - ENSP00000439634 [81%]
ST3GAL3-005 - ENSP00000361442 [80%]
ST3GAL3-008 - ENSP00000361441 [80%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:800 

Literature conformity

Partly consistent with gene/protein characterization data 

RNA consistency

Not done 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line HeLa shows positivity in vesicles.
More information
 

Antibody dilution

1:88 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406360)
More information
 

Target mass (kDa)

43.8, 42.2, 38.7, 31.6, 22.6, 21.2, 20.9, 20.8, 19.0, 17.4, 16.8, 13.7, 13.0, 11.9 

Antibody dilution

1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3550 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 « 
 
ST3GAL3-001
 
ST3GAL3-003
 
ST3GAL3-005
 
ST3GAL3-006
 
ST3GAL3-007
 
ST3GAL3-008
 
ST3GAL3-009
 
ST3GAL3-012
 
ST3GAL3-016
 
ST3GAL3-018
 
ST3GAL3-027
 
ST3GAL3-028
 
ST3GAL3-030
 
ST3GAL3-032
 
ST3GAL3-202
 
ST3GAL3-205
 
ST3GAL3-208
 
ST3GAL3-209
 
 »