PRKCG

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA047870

 

Antibody HPA054560

 

Antibody CAB013051

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Zymed
 

Product name

HPA047870 HPA054560 13-3800 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

13 13 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

43 42  

Antigen sequence

GEYYNVPVADADNCSLLQKFEACNYPLELYERVRMGPSSSPIP
 
PPDRLVLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM
 
 

Matching transcripts

PRKCG-001 - ENSP00000263431 [100%]
PRKCG-202 - ENSP00000443493 [100%]
PRKCG-203 - ENSP00000438090 [100%]
 PRKCG-001 - ENSP00000263431 [100%]
PRKCG-203 - ENSP00000438090 [100%]
PRKCG-202 - ENSP00000443493 [98%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
More information
 Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
More information
 Immunohistochemical staining of human cerebellum shows distinct cytoplasmic positivity in Purkinje cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:900 1:75 1:20 

Literature conformity

Partly consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data Not applicable Mainly consistent with RNAseq data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

79.8, 78.4, 62.0 79.8, 78.4, 62.0 79.8, 78.4, 62.0, 36.3, 11.4, 4.1, 2.2 

Antibody dilution

1:260 1:80 1:500 

Validation WB

Uncertain: No bands detected Uncertain: No bands detected Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:2100 1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
PRKCG-001
 
PRKCG-202
 
PRKCG-203