AAMP

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA031868

 

Antibody CAB017717

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA031868 2443.00.02 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

14 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Genetic immunization 

Length (aa)

91  

Antigen sequence

RIWDLKQGSPIHVLKGTEGHQGPLTCVAANQDGSLILTGSVDCQAKLVSA
TTGKVVGVFRPETVASQPSLGEGEESESNSVESLGFCSVMP
 
 

Matching transcripts

AAMP-001 - ENSP00000248450 [100%]
AAMP-002 - ENSP00000403343 [100%]
AAMP-005 - ENSP00000416394 [100%]
AAMP-009 - ENSP00000396295 [86%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in glandular cells and distinct staining of blood vessels and smooth muscle cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:250 

Literature conformity

 Consistent with extensive gene/protein characterization data 

RNA consistency

 Mainly consistent with RNA expression data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & microtubules.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in microtubules.
More information
 

Antibody dilution

1:36 1:62 

Validation IF

Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

46.8, 44.7, 20.0 46.8, 44.7, 22.0, 20.0 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
AAMP-001
 
AAMP-002
 
AAMP-005
 
AAMP-009