ATF4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA036934

 

Antibody CAB011596

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Abcam plc
 

Product name

HPA036934 ab23760 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

12 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

76  

Antigen sequence

MDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTV
NPIGHLPESLTKPDQVAPFTFLQPLP
 
 

Matching transcripts

ATF4-001 - ENSP00000384587 [100%]
ATF4-002 - ENSP00000336790 [100%]
ATF4-201 - ENSP00000379912 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human lateral ventricle shows strong nuclear positivity in glial cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:50 

Validation IH

 Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line CACO-2 shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm & microtubule organizing center.
More information
 

Antibody dilution

1:88 1:13 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

38.6 38.6 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:12000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ATF4-001
 
ATF4-002
 
ATF4-201