HERC2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA048389

 

Antibody CAB017188

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Kazusa DNA Research Institute
 

Product name

HPA048389 GX1144 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

13 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

71  

Antigen sequence

LTGASGNASGLPGVEALVGWLLDHSDIQVTELSDADTVSDEYSDEEVVED
MDDAAYSMSTGAVVTESQTYK
 
 

Matching transcripts

HERC2-001 - ENSP00000261609 [97%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human tonsil shows distinct cytoplasmic positivity in subsets of cells.
More information
 Immunohistochemical staining of human tonsil shows distinct cytoplasmic positivity in subsets of cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:25 1:600 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNA expression data Mainly consistent with RNA expression data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles.
More information
 Application not done for this antibody. 

Antibody dilution

1:29  

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available.  

         Western Blot

Image

  

Description

Target too small/large to be analyzed with the present setup Target too small/large to be analyzed with the present setup 

Target mass (kDa)

527.2 527.2, 20.6 

Antibody dilution

  

Validation WB

Target too small/large to be analyzed with the present setup Target too small/large to be analyzed with the present setup 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:1200  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
HERC2-001