MPDU1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA014845

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA014845 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

42 

Antigen sequence

AEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSK
 

Matching transcripts

MPDU1-001 - ENSP00000250124 [100%]
MPDU1-006 - ENSP00000414071 [100%]
MPDU1-022 - ENSP00000379758 [100%]
MPDU1-024 - ENSP00000462839 [100%]
MPDU1-026 - ENSP00000464158 [100%]
MPDU1-201 - ENSP00000483943 [100%]
MPDU1-202 - ENSP00000483915 [100%]
MPDU1-203 - ENSP00000479257 [100%]
MPDU1-025 - ENSP00000463037 [95%]
MPDU1-028 - ENSP00000463966 [81%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:400 

Literature conformity

Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in endoplasmic reticulum.
More information
 

Antibody dilution

1:167 

Validation IF

Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

32.0, 26.6, 22.6, 20.9, 20.8, 19.8, 16.7, 16.5, 12.7 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
MPDU1-001
 
MPDU1-006
 
MPDU1-022
 
MPDU1-024
 
MPDU1-025
 
MPDU1-026
 
MPDU1-028
 
MPDU1-201
 
MPDU1-202
 
MPDU1-203