RIPK3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA055087

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA055087 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

95 

Antigen sequence

EMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQ
EEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPG
 

Matching transcripts

RIPK3-001 - ENSP00000216274 [100%]
RIPK3-009 - ENSP00000451840 [100%]
 

Other gene match

RP11-934B9.3 - ENSG00000258973 [99%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:1400 

Literature conformity

Not consistent with gene/protein characterization data 

RNA consistency

Mainly consistent with RNA expression data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

56.9, 27.0, 17.6 

Antibody dilution

1:410 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3300 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
RIPK3-001
 
RIPK3-009