TULP4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA005445

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA005445 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

149 

Antigen sequence

VLLHESDGVLGMSWNYPIFLVEDSSESDTDSDDYAPPQDGPAAYPIPVQN
IKPLLTVSFTSGDISLMNNYDDLSPTVIRSGLKEVVAQWCTQGDLLAVAG
MERQTQLGELPNGPLLKSAMVKFYNVRGEHIFTLDTLVQRPIISICWGH
 

Matching transcripts

TULP4-001 - ENSP00000356064 [100%]
TULP4-002 - ENSP00000356061 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:25 

Literature conformity

Consistent with gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

169.0, 75.9 

Antibody dilution

1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
TULP4-001
 
TULP4-002