STK33

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA015742

 

Antibody HPA056855

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA015742 HPA056855 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

134 83 

Antigen sequence

KCPDCSSASQKDVLCVCSSKTRVPPVLVVEMSQTSSIGSAESLISLERKK
EKNINRDITSRKDLPSRTSNVERKASQQQWGRGNFTEGKVPHIRIENGAA
IEEIYTFGRILGKGSFGIVIEATDKETETKWAIK
 
EEKLKSYQPWGNVPDANYTSDEEEEKQSTAYEKQFPATSKDNFDMCSSSF
TSSKLLPAEIKGEMEKTPVTPSQGTATKYPAKS
 

Matching transcripts

STK33-001 - ENSP00000320754 [100%]
STK33-002 - ENSP00000379905 [100%]
STK33-004 - ENSP00000416750 [100%]
STK33-010 - ENSP00000403599 [100%]
 STK33-001 - ENSP00000320754 [100%]
STK33-002 - ENSP00000379905 [100%]
STK33-003 - ENSP00000351743 [100%]
STK33-004 - ENSP00000416750 [100%]
STK33-017 - ENSP00000436418 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human duodenum shows granular cytoplasmic positivity in glandular cells.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:25  

Literature conformity

No avaliable gene/protein characterization data  

RNA consistency

Mainly not consistent with RNA expression data  

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus & cytoplasm.
More information
 

Antibody dilution

 1:48 

Validation IF

 Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

57.8, 18.8 57.8, 53.5, 37.1 

Antibody dilution

1:250 1:160 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:1900 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
STK33-001
 
STK33-002
 
STK33-003
 
STK33-004
 
STK33-010
 
STK33-017