AAR2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA048645

 

Antibody CAB034220

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA048645 sc-85419 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

11 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

87  

Antigen sequence

LAKRLFFEGATVVILNMPKGTEFGIDYNSWEVGPKFRGVKMIPPGIHFLH
YSSVDKANPKEVGPRMGFFLSLHQRGLTVLRWSTLRE
 
 

Matching transcripts

AAR2-001 - ENSP00000363043 [100%]
AAR2-002 - ENSP00000380455 [100%]
AAR2-003 - ENSP00000313674 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human cerebral cortex shows moderate nucleolar positivity in neurons.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:150 1:300 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

45.0, 43.5 45.0, 43.5 

Antibody dilution

1:210 1:500 

Validation WB

Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:1650  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
AAR2-001
 
AAR2-002
 
AAR2-003