ARHGEF9

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035419

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA035419 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

75 

Antigen sequence

DEEGWFPASFVRLWVNQEDEVEEGPSDVQNGHLDPNSDCLCLGRPLQNRD
QMRANVINEIMSTERHYIKHLKDIC
 

Matching transcripts

ARHGEF9-001 - ENSP00000253401 [100%]
ARHGEF9-002 - ENSP00000364012 [100%]
ARHGEF9-004 - ENSP00000364006 [100%]
ARHGEF9-203 - ENSP00000399994 [85%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:180 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

 

Target mass (kDa)

61.0, 58.7, 56.4, 55.0 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ARHGEF9-001
 
ARHGEF9-002
 
ARHGEF9-004
 
ARHGEF9-203