DCAF8

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA027218

 

Antibody HPA027381

 

Antibody HPA044837

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA027218 HPA027381 HPA044837 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 5 9 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

68 73 66 

Antigen sequence

EDKDSDSMEDTGHYSINDENRVHDRSEEEEEEEEEEEEEQPRRRVQRKRA
NRDQDSSDDERALEDWVS
 
MSSKGSSTDGRTDLANGSLSSSPEEMSGAEEGRETSSGIEVEASDLSLSL
TGDDGGPNRTSTESRGTDTESSG
 
SSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEI
TEKYPEWLQSHRESLP
 

Matching transcripts

DCAF8-001 - ENSP00000357052 [100%]
DCAF8-002 - ENSP00000357053 [100%]
DCAF8-003 - ENSP00000318227 [100%]
DCAF8-004 - ENSP00000476407 [100%]
DCAF8-005 - ENSP00000476351 [100%]
DCAF8-007 - ENSP00000413688 [100%]
DCAF8-010 - ENSP00000477012 [100%]
DCAF8-018 - ENSP00000477464 [100%]
DCAF8-201 - ENSP00000476284 [100%]
 DCAF8-001 - ENSP00000357052 [100%]
DCAF8-002 - ENSP00000357053 [100%]
DCAF8-003 - ENSP00000318227 [100%]
DCAF8-004 - ENSP00000476407 [100%]
DCAF8-005 - ENSP00000476351 [100%]
DCAF8-006 - ENSP00000411875 [100%]
DCAF8-007 - ENSP00000413688 [100%]
DCAF8-008 - ENSP00000384118 [100%]
DCAF8-018 - ENSP00000477464 [100%]
DCAF8-201 - ENSP00000476284 [100%]
 DCAF8-201 - ENSP00000476284 [97%]
 

Other gene match

DCAF8 - ENSG00000258465 [100%]
 DCAF8 - ENSG00000258465 [100%]
 PEX19 - ENSG00000162735 [100%]
DCAF8 - ENSG00000258465 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human kidney shows distinct nuclear and cytoplasmic positivity in cells in tubules.
More information
 Immunohistochemical staining of human heart muscle shows strong positivity in cytoplasm and intercalated discs of myocytes.
More information
 Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:180 1:50 1:200 

Literature conformity

No avaliable characterization data No avaliable characterization data No avaliable characterization data 

RNA consistency

Not done Not done Mainly consistent with RNAseq data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

84.8, 66.9, 46.5, 30.6, 23.5, 14.0 84.8, 66.9, 46.5, 30.6, 23.5, 11.6, 11.2 84.8, 33.7, 32.8, 26.1, 23.3 

Antibody dilution

1:250 1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 1:12000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 « 
 
DCAF8-001
 
DCAF8-002
 
DCAF8-003
 
DCAF8-004
 
DCAF8-005
 
DCAF8-006
 
DCAF8-007
 
DCAF8-008
 
DCAF8-010
 
DCAF8-018
 
DCAF8-201
 
 »