CNDP2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA036898

 

Antibody HPA036899

 

Antibody CAB026196

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 R&D Systems
 

Product name

HPA036898 HPA036899 MAB3560 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

13 13 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

74 96  

Antigen sequence

AKWVAIQSVSAWPEKRGEIRRMMEVAAADVKQLGGSVELVDIGKQKLPDG
SEIPLPPILLGRLGSDPQKKTVCI
 
IPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVCISDNYWLGKKK
PCITYGLRGICYFFIEVECSNKDLHSGVYGGSVHEAMTDLILLMGS
 
 

Matching transcripts

CNDP2-001 - ENSP00000325548 [100%]
CNDP2-004 - ENSP00000462311 [100%]
CNDP2-011 - ENSP00000464151 [100%]
CNDP2-014 - ENSP00000463314 [100%]
CNDP2-016 - ENSP00000463702 [100%]
CNDP2-019 - ENSP00000462673 [100%]
CNDP2-021 - ENSP00000463182 [100%]
CNDP2-022 - ENSP00000463222 [100%]
CNDP2-031 - ENSP00000464014 [100%]
CNDP2-017 - ENSP00000463816 [91%]
 CNDP2-001 - ENSP00000325548 [100%]
CNDP2-004 - ENSP00000462311 [100%]
CNDP2-006 - ENSP00000325756 [100%]
CNDP2-022 - ENSP00000463222 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:3000 1:4500 1:2500 

Literature conformity

Consistent with gene/protein characterization data Consistent with gene/protein characterization data Consistent with gene/protein characterization data 

RNA consistency

Consistent with RNAseq data Consistent with RNAseq data Consistent with RNAseq data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

52.9, 27.7, 16.5, 15.2, 14.9, 14.3, 13.7, 13.6, 9.9 52.9, 43.8, 27.7 52.9, 43.8, 27.7, 22.4, 16.5, 15.9, 15.2, 14.9, 14.3, 13.7, 13.6, 12.5, 10.3, 9.9, 9.4, 6.4 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 « 
 
CNDP2-001
 
CNDP2-004
 
CNDP2-006
 
CNDP2-011
 
CNDP2-014
 
CNDP2-016
 
CNDP2-017
 
CNDP2-019
 
CNDP2-021
 
CNDP2-022
 
CNDP2-031
 
 »