CA1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA006558

 

Antibody CAB025790

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 R&D Systems
 

Product name

HPA006558 MAB2180 

Host species

Rabbit Rat 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

4 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

139  

Antigen sequence

NGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEII
NVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVD
GVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMK
 
 

Matching transcripts

CA1-001 - ENSP00000430656 [100%]
CA1-003 - ENSP00000429798 [100%]
CA1-010 - ENSP00000429843 [100%]
CA1-015 - ENSP00000430861 [100%]
CA1-201 - ENSP00000256119 [100%]
CA1-202 - ENSP00000392338 [100%]
CA1-203 - ENSP00000401551 [100%]
CA1-204 - ENSP00000443517 [100%]
CA1-004 - ENSP00000430471 [99%]
CA1-006 - ENSP00000427852 [99%]
CA1-013 - ENSP00000430737 [99%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human bone marrow shows strong nuclear positivity in bone marrow poietic cells.
More information
 Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in most cells of red and white pulp.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:75 1:10000 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Consistent with RNAseq data Mainly consistent with RNAseq data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

28.9, 27.8, 19.3, 16.4, 16.3 28.9, 27.8, 21.4, 19.7, 19.3, 16.4, 16.3, 15.1, 14.0, 13.3, 11.2, 9.4, 9.0, 2.6 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:500  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 « 
 
CA1-001
 
CA1-003
 
CA1-004
 
CA1-006
 
CA1-010
 
CA1-013
 
CA1-015
 
CA1-201
 
CA1-202
 
CA1-203
 
CA1-204
 
 »