ARL8B

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA038759

 

Antibody HPA040515

 

Antibody HPA045924

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA038759 HPA040515 HPA045924 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 10 10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

36 33 50 

Antigen sequence

EKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGA
 
GLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRK
 
ALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS
 

Matching transcripts

ARL8B-001 - ENSP00000256496 [94%]
 ARL8B-001 - ENSP00000256496 [97%]
ARL8B-005 - ENSP00000402996 [97%]
 ARL8B-001 - ENSP00000256496 [98%]
 

Other gene match

ARL8A - ENSG00000143862 [100%]
 ARL8A - ENSG00000143862 [100%]
 ARL8A - ENSG00000143862 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.
More information
 Immunohistochemical staining of human cerebral cortex shows moderate positivity in a subset of glial cells
More information
 Immunohistochemical staining of human cerebral cortex shows moderate positivity in a subset of glial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:200 1:30 1:65 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein Uncertain: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein Uncertain: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

21.5, 21.4 21.5, 21.4, 18.6 21.5, 21.4 

Antibody dilution

1:250 1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:12000 1:3000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ARL8B-001
 
ARL8B-005