PSRC1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA049315

 

Antibody HPA056561

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA049315 HPA056561 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

77 92 

Antigen sequence

DLEEDVRFIVDETLDFGGLSPSDSREEEDITVLVTPEKPLRRGLSHRSDP
NAVAPAPQGVRLSLGPLSPEKLEEILD
 
NRLAAQLEQCALQDRESAGEGLGPRRVKPSPRRETFVLKDSPVRDLLPTV
NSLTRSTPSPSSLTPRLRSNDRKGSVRALRATSGKRPSNMKR
 

Matching transcripts

PSRC1-001 - ENSP00000358923 [100%]
PSRC1-002 - ENSP00000358920 [100%]
PSRC1-003 - ENSP00000474667 [100%]
PSRC1-005 - ENSP00000387791 [100%]
PSRC1-006 - ENSP00000413186 [100%]
PSRC1-009 - ENSP00000386323 [100%]
PSRC1-010 - ENSP00000358919 [100%]
PSRC1-201 - ENSP00000358925 [100%]
PSRC1-202 - ENSP00000413591 [100%]
 PSRC1-001 - ENSP00000358923 [100%]
PSRC1-002 - ENSP00000358920 [100%]
PSRC1-003 - ENSP00000474667 [100%]
PSRC1-005 - ENSP00000387791 [100%]
PSRC1-006 - ENSP00000413186 [100%]
PSRC1-009 - ENSP00000386323 [100%]
PSRC1-010 - ENSP00000358919 [100%]
PSRC1-201 - ENSP00000358925 [100%]
PSRC1-202 - ENSP00000413591 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:400  

Literature conformity

Partly consistent with gene/protein characterization data  

RNA consistency

Mainly not consistent with RNAseq data  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

38.8, 35.6, 33.6, 25.0, 22.3 38.8, 35.6, 33.6, 25.0, 22.3 

Antibody dilution

1:100 1:200 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:30000 1:2450 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 

Antibody dilution

 1:61 

Validation IF

 Supportive: The subcellular location is supported by literature. 
 

ANTIGEN VIEW

? »
 
 
 
PSRC1-001
 
PSRC1-002
 
PSRC1-003
 
PSRC1-005
 
PSRC1-006
 
PSRC1-009
 
PSRC1-010
 
PSRC1-201
 
PSRC1-202