AHI1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA046684

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA046684 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

105 

Antigen sequence

QVAMYSDLPFKSPIRDISYHPFENMVAFCAFGQNEPILLYIYDFHVAQQE
AEMFKRYNGTFPLPGIHQSQDALCTCPKLPHQGSFQIDEFVHTESSSTKM
QLVKQ
 

Matching transcripts

AHI1-001 - ENSP00000356773 [100%]
AHI1-002 - ENSP00000435710 [100%]
AHI1-003 - ENSP00000322478 [100%]
AHI1-008 - ENSP00000356774 [100%]
AHI1-009 - ENSP00000388650 [100%]
AHI1-011 - ENSP00000265602 [100%]
AHI1-202 - ENSP00000416867 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in renal tubules.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:2000 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:200 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

 

Target mass (kDa)

137.1, 120.9, 76.3, 61.7, 57.0 

Antibody dilution

1:2070 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:16600 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
AHI1-001
 
AHI1-002
 
AHI1-003
 
AHI1-008
 
AHI1-009
 
AHI1-011
 
AHI1-202