ARHGEF4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA018267

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA018267 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

76 

Antigen sequence

VLYYKGRLDMDGLEVVDLEDGKDRDLHVSIKNAFRLHRGATGDSHLLCTR
KPEQKQRWLKAFAREREQVQLDQETG
 

Matching transcripts

ARHGEF4-001 - ENSP00000316845 [100%]
ARHGEF4-002 - ENSP00000432267 [100%]
ARHGEF4-005 - ENSP00000387285 [100%]
ARHGEF4-009 - ENSP00000348017 [100%]
ARHGEF4-012 - ENSP00000432301 [100%]
ARHGEF4-201 - ENSP00000376680 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:15 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

79.1, 76.4, 71.8, 71.1, 33.2 

Antibody dilution

1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ARHGEF4-001
 
ARHGEF4-002
 
ARHGEF4-005
 
ARHGEF4-009
 
ARHGEF4-012
 
ARHGEF4-201