RNASEH2B

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA040084

 

Antibody HPA041469

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA040084 HPA041469 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

97 84 

Antigen sequence

VVDNVFPNCILLLKLPGLEKLLHHVTEEKGNPEIDNKKYYKYSKEKTLKW
LEKKVNQTVAALKTNNVNVSSRVQSTAFFSGDQASTDKEEDYIRYAH
 
ISDYIPKELSDDLSKYLKLPEPSASLPNPPSKKIKLSDEPVEAKEDYTKF
NTKDLKTEKKNSKMTAAQKALAKVDKSGMKSIDT
 

Matching transcripts

RNASEH2B-001 - ENSP00000337623 [100%]
RNASEH2B-201 - ENSP00000389877 [100%]
 RNASEH2B-001 - ENSP00000337623 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human stomach shows strong nuclear and cytoplasmic positivity in glandular cells.
More information
  

Retrieval method

HIER pH6  

Antibody dilution

1:100  

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
More information
 

Antibody dilution

1:127 1:4 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

  

Target mass (kDa)

35.1, 29.0 35.1 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
RNASEH2B-001
 
RNASEH2B-201