DBNL

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA020265

 

Antibody HPA027735

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA020265 HPA027735 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

82 81 

Antigen sequence

INWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEK
VAKASGANYSFHKESGRFQDVGPQAPVGSVYQ
 
PPEQETFYEQPPLVQQQGAGSEHIDHHIQGQGLSGQGLCARALYDYQAAD
DTEISFDPENLITGIEVIDEGWWRGYGPDGH
 

Matching transcripts

DBNL-001 - ENSP00000411701 [100%]
DBNL-018 - ENSP00000419992 [100%]
DBNL-019 - ENSP00000417653 [100%]
DBNL-009 - ENSP00000398931 [96%]
 DBNL-001 - ENSP00000411701 [100%]
DBNL-003 - ENSP00000416421 [100%]
DBNL-004 - ENSP00000415173 [100%]
DBNL-005 - ENSP00000405343 [100%]
DBNL-009 - ENSP00000398931 [100%]
DBNL-017 - ENSP00000397855 [100%]
DBNL-018 - ENSP00000419992 [100%]
DBNL-019 - ENSP00000417653 [100%]
DBNL-201 - ENSP00000417749 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.
More information
 Immunohistochemical staining of human lymph node shows distinct cytoplasmic positivity in both reaction centre cells and in lymphoid cells outside reaction centra.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:15 1:25 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

49.0, 48.3, 48.2, 40.2 49.0, 48.3, 48.2, 45.7, 43.0, 40.2, 38.0, 37.1, 15.1 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

 1:10 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
DBNL-001
 
DBNL-003
 
DBNL-004
 
DBNL-005
 
DBNL-009
 
DBNL-017
 
DBNL-018
 
DBNL-019
 
DBNL-201